Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria oxyR protein

This Bacteria oxyR protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OxyR, Probable hydrogen peroxide-inducible genes activator

UniProt

Q9X5P2

Expression Region

1-312aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Streptomyces viridosporus

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRKRRRQPSLAQLRAFAAVAEHLHFRDAAAAIGMSQPALSGAVSALEESLGVTLLERTTRKVLLSPAGERLAARAKSVLAEVGALVEEADALQAPFTGVLRLGVIPTVAPYVLPTVLRLVHDRYPRLDLQVHEEQTASLLDGLTGGRLDLLLLAVPLGVPGVVELPLFDEDFVLVTPLEHGLGGREGIPRKALRELNLLLLDEGHCLRDQALDICREAGSAGVAATTTAAGLSTLVQLVAGGLGVTLLPHTAVQVETTRSGRLLTGRFADPAPGRRIALAMRTGAARAAEYEELAAALREAMRDLPVRIVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Barene
TRC-B129133-5G 5 g

Barene

Sign In for Pricing
View Details
GABRB1 Polyclonal Antibody
E-AB-15059-01 20 µL

GABRB1 Polyclonal Antibody

Sign In for Pricing
View Details
GABRB1 Polyclonal Antibody
E-AB-15059-02 60 µL

GABRB1 Polyclonal Antibody

Sign In for Pricing
View Details
GABRB1 Polyclonal Antibody
E-AB-15059-03 120 µL

GABRB1 Polyclonal Antibody

Sign In for Pricing
View Details
GABRB1 Polyclonal Antibody
E-AB-15059-04 200 µL

GABRB1 Polyclonal Antibody

Sign In for Pricing
View Details
CD50 (ICAM-3) (ICAM3/1019), 1mg/mL
BNUM1019-50 1x 50 µL

CD50 (ICAM-3) (ICAM3/1019), 1mg/mL

Sign In for Pricing
View Details