Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Commd5 protein

This Rat Commd5 protein spans the amino acid sequence from region 2-224aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hypertension-related calcium-regulated gene protein (HCaRG)

UniProt

Q9ERR2

Expression Region

2-224aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAP Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2426635 100 µL

SCAP Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Lentiviral mouse Eprs shRNA (UAS) - Lentiviral mouse Eprs shRNA (UAS, iRFP) (100)
GTR15290439 1 Vial

Lentiviral mouse Eprs shRNA (UAS) - Lentiviral mouse Eprs shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Recombinant Human PVRIG (C-mFc)
MBS2569214-01 0.01 mg

Recombinant Human PVRIG (C-mFc)

Sign In for Pricing
View Details
Recombinant Human PVRIG (C-mFc)
MBS2569214-02 0.05 mg

Recombinant Human PVRIG (C-mFc)

Sign In for Pricing
View Details
Recombinant Human PVRIG (C-mFc)
MBS2569214-03 5x 0.05 mg

Recombinant Human PVRIG (C-mFc)

Sign In for Pricing
View Details
PLAU Antibody
orb1258236 100 µL

PLAU Antibody

Sign In for Pricing
View Details