Rat Commd5 protein
This Rat Commd5 protein spans the amino acid sequence from region 2-224aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Hypertension-related calcium-regulated gene protein (HCaRG)
UniProt
Q9ERR2
Expression Region
2-224aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Rattus norvegicus (Rat)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
31.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6305331-01 0.2 mL
HADHB, CT (HADHB, Trifunctional enzyme subunit beta, mitochondrial, TP-beta, 3-ketoacyl-CoA thiolase, Acetyl-CoA acyltransferase, Beta-ketothiolase) (FITC)
Sign In for Pricing
View Details MBS6305331-02 5x 0.2 mL
HADHB, CT (HADHB, Trifunctional enzyme subunit beta, mitochondrial, TP-beta, 3-ketoacyl-CoA thiolase, Acetyl-CoA acyltransferase, Beta-ketothiolase) (FITC)
Sign In for Pricing
View Details 
GTR15277745 1 Vial
Lentiviral mouse Zfp473 shRNA (UAS) - Lentiviral mouse Zfp473 shRNA (UAS) (25)
Sign In for Pricing
View Details