Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCR3 protein

This Human CXCR3 protein spans the amino acid sequence from region 4-50aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CKR-L2 (G protein-coupled receptor 9) (Interferon-inducible protein 10 receptor) (IP-10 receptor) (CD_antigen, CD183) (CXC-R3) (CXCR-3) (GPR9)

UniProt

P49682

Expression Region

4-50aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadherin 16 Rabbit Monoclonal Antibody
AMRe87096-01 1 Each

Cadherin 16 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Cadherin 16 Rabbit Monoclonal Antibody
AMRe87096-02 50 µL

Cadherin 16 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Cadherin 16 Rabbit Monoclonal Antibody
AMRe87096-03 100 µL

Cadherin 16 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Phactr4 ORF Vector (Mouse) (pORF)
ORF053895 1.0 µg DNA

Phactr4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
DNMT1 Protein-GST Fusion
B2024091 20 µg

DNMT1 Protein-GST Fusion

Sign In for Pricing
View Details
TLR8 (Toll-like Receptor 8, CD288, MGC119599, MGC119600) (MaxLight 750) discontinued
252767-ML750 100 µL

TLR8 (Toll-like Receptor 8, CD288, MGC119599, MGC119600) (MaxLight 750) discontinued

Sign In for Pricing
View Details