Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine Apolipoprotein AI protein

This Bovine Apolipoprotein AI protein spans the amino acid sequence from region 25-265aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apolipoprotein A1 (Apo-AI) (ApoA-I)

UniProt

P15497

Expression Region

25-265aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APPBP1 (NAE1) (NM_001286500) Human Tagged ORF Clone
RG238788 10 µg

APPBP1 (NAE1) (NM_001286500) Human Tagged ORF Clone

Sign In for Pricing
View Details
BAF180 Recombinant Rabbit Monoclonal Antibody [PSH02-34]
HA721811 100 µL

BAF180 Recombinant Rabbit Monoclonal Antibody [PSH02-34]

Sign In for Pricing
View Details
3-Indolepropionic Acid
TRC-I627170-10G 10 g

3-Indolepropionic Acid

Sign In for Pricing
View Details
CD44 Mouse Monoclonal Antibody [Clone ID: 8E2F3]
AM06286SU-N 100 µL

CD44 Mouse Monoclonal Antibody [Clone ID: 8E2F3]

Sign In for Pricing
View Details
Slingshot homolog 1 (SSH1) (NM_001161330) Human Over-expression Lysate
LC431565 20 µg

Slingshot homolog 1 (SSH1) (NM_001161330) Human Over-expression Lysate

Sign In for Pricing
View Details
SOX1 (NM_005986) Human Over-expression Lysate
LC401812 20 µg

SOX1 (NM_005986) Human Over-expression Lysate

Sign In for Pricing
View Details