Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine Apolipoprotein AI protein

This Bovine Apolipoprotein AI protein spans the amino acid sequence from region 25-265aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apolipoprotein A1 (Apo-AI) (ApoA-I)

UniProt

P15497

Expression Region

25-265aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF488A conjugate, 0.1mg/mL
BNC882988-500 1x 500 µL

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fmoc-Thr (t-Bu) Wang Resin
H0751501324.5G 5 g

Fmoc-Thr (t-Bu) Wang Resin

Sign In for Pricing
View Details
GATA3 Antibody
OC-465-01 50 μL

GATA3 Antibody

Sign In for Pricing
View Details
GATA3 Antibody
OC-465-02 100 µL

GATA3 Antibody

Sign In for Pricing
View Details
GATA3 Antibody
OC-465-03 1 mL

GATA3 Antibody

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2864), CF405S conjugate, 0.1mg/mL
BNC042864-500 1x 500 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2864), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details