What is the catalog number for Human MYC protein?

The catalog number for Human MYC protein is orb604264.

What sizes are available for Human MYC protein?

Human MYC protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human MYC protein come in?

Human MYC protein is available in 3 different pack sizes.

Is Human MYC protein in stock?

Human MYC protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human MYC protein

This Human MYC protein spans the amino acid sequence from region 169-439aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Class E basic helix-loop-helix protein 39 (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) (BHLHE39)

UniProt

P01106

Expression Region

169-439aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA