Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-G protein

This Human HLA-G protein spans the amino acid sequence from region 25-338aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HLA G antigen (MHC class I antigen G) (HLA-6.0) (HLAG)

UniProt

P17693

Expression Region

25-338aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLD2 (DNA Polymerase delta Subunit 2, DNA Polymerase delta Subunit p50, POLD2) (PE)
MBS6458262-01 0.2 mL

POLD2 (DNA Polymerase delta Subunit 2, DNA Polymerase delta Subunit p50, POLD2) (PE)

Sign In for Pricing
View Details
POLD2 (DNA Polymerase delta Subunit 2, DNA Polymerase delta Subunit p50, POLD2) (PE)
MBS6458262-02 5x 0.2 mL

POLD2 (DNA Polymerase delta Subunit 2, DNA Polymerase delta Subunit p50, POLD2) (PE)

Sign In for Pricing
View Details
MEF2C Polyclonal Antibody
RD70120A-01 20μL

MEF2C Polyclonal Antibody

Sign In for Pricing
View Details
MEF2C Polyclonal Antibody
RD70120A-02 60μL

MEF2C Polyclonal Antibody

Sign In for Pricing
View Details
MEF2C Polyclonal Antibody
RD70120A-03 120μL

MEF2C Polyclonal Antibody

Sign In for Pricing
View Details
MEF2C Polyclonal Antibody
RD70120A-04 200μL

MEF2C Polyclonal Antibody

Sign In for Pricing
View Details