Mouse Gzma protein
This Mouse Gzma protein spans the amino acid sequence from region 29-260aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Autocrine thymic lymphoma granzyme-like serine protease (CTLA-3) (Fragmentin-1) (T cell-specific serine protease 1) (TSP-1) (Ctla-3) (Ctla3) (Mtsp-1)
UniProt
P11032
Expression Region
29-260aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
31.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
038559-ML405 100 µL
MPHOSPH9, NT (MPHOSPH9, MPP9, M-phase phosphoprotein 9) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
TMPJ-01465-01 5 µg
GM-CSF/CSF2 Protein, Human, Recombinant (E. coli)
Sign In for Pricing
View Details TMPJ-01465-02 10 µg
GM-CSF/CSF2 Protein, Human, Recombinant (E. coli)
Sign In for Pricing
View Details TMPJ-01465-03 20 µg
GM-CSF/CSF2 Protein, Human, Recombinant (E. coli)
Sign In for Pricing
View Details TMPJ-01465-04 50 µg
GM-CSF/CSF2 Protein, Human, Recombinant (E. coli)
Sign In for Pricing
View Details