Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus TOP1 protein

This Virus TOP1 protein spans the amino acid sequence from region 1-314aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNA topoisomerase I (Late protein H6) (TopIB)

UniProt

P68697

Expression Region

1-314aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRALFYKDGKLFTDNNFLNPVSDDNPAYEVLQHVKIPTHLTDVVVYEQTWEEALTRLIFVGSDSKGRRQYFYGKMHVQNRNAKRDRIFVRVYNVMKRINCFINKNIKKSSTDSNYQLAVFMLMETMFFIRFGKMKYLKENETVGLLTLKNKHIEISPDEIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDDSSPEEFLFNKLSERKVYECIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPSPKKLIALTIKQTAEVVGHTPSISKRAYMATTILEMVKDKNFLDVVSKTTFDEFLSIVVDHVKSSTDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N6AMT2 Antibody
22-918 100 µL

N6AMT2 Antibody

Sign In for Pricing
View Details
KIAA1274 (C-Term) Rabbit pAb
MBS8552059-01 0.1 mL

KIAA1274 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
KIAA1274 (C-Term) Rabbit pAb
MBS8552059-02 0.1 mL (AF405L)

KIAA1274 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
KIAA1274 (C-Term) Rabbit pAb
MBS8552059-03 0.1 mL (AF405S)

KIAA1274 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
KIAA1274 (C-Term) Rabbit pAb
MBS8552059-04 0.1 mL (AF610)

KIAA1274 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
KIAA1274 (C-Term) Rabbit pAb
MBS8552059-05 0.1 mL (AF635)

KIAA1274 (C-Term) Rabbit pAb

Sign In for Pricing
View Details