Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria Enterobacteria phage MS2 Capsid protein protein

This Bacteria Enterobacteria phage MS2 Capsid protein protein spans the amino acid sequence from region 28-488aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Poly (3-hydroxybutyrate) depolymerase, PHB depolymerase, EC 3.1.1.75

UniProt

P12625

Expression Region

28-488aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Ralstonia pickettii (Burkholderia pickettii)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATAGPGAWSSQQTWAADSVNGGNLTGYFYWPASQPTTPNGKRALVLVLHGCVQTASGDVIDNANGAGFNWKSVADQYGAVILAPNATGNVYSNHCWDYANASPSRTAGHVGVLLDLVNRFVTNSQYAIDPNQVYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPGTTTAQIGYVPSGFTATTAANKCNAWAGSNAGKFSTQIAGAVWGTSDYTVAQAYGPMDAAAMRLVYGGNFTQGSQVSISGGGTNTPYTDSNGKVRTHEISVSGMAHAWPAGTGGDNTNYVDATHINYPVFVMDYWVKNNLRAGSGTGQAGSAPTGLAVTATTSTSVSLSWNAVANASSYGVYRNGSKVGSATATAYTDSGLIAGTTYSYTVTAVDPTAGESQPSAAVSATTKSAFTCTATTASNYAHVQAGRAHDSGGIAYANGSNQSMGLDNLFYTSTLAQTAAGYYIVGNCP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CEACAM5/CD66e Antibody (SPM584) [PerCP]
NBP2-34851PCP 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (SPM584) [PerCP]

Sign In for Pricing
View Details
HHIPL1 (NM_032425) Human Recombinant Protein
E45H36461M5 20 µg

HHIPL1 (NM_032425) Human Recombinant Protein

Sign In for Pricing
View Details
Integrin αV/β5 (P1F6) : m-IgG1 BP-HRP Bundle
sc-541629 1 Kit

Integrin αV/β5 (P1F6) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Mmu-miR-466m-5p mimic
HY-R03188-01 5 nmol

Mmu-miR-466m-5p mimic

Sign In for Pricing
View Details
Mmu-miR-466m-5p mimic
HY-R03188-02 20 nmol

Mmu-miR-466m-5p mimic

Sign In for Pricing
View Details
Porcine Matrix Extracellular Phosphoglycoprotein MEPE ELISA Kit
BG-POR11574 1 Each

Porcine Matrix Extracellular Phosphoglycoprotein MEPE ELISA Kit

Sign In for Pricing
View Details