Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat C5 protein

This Rat C5 protein spans the amino acid sequence from region 1-77aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C5Complement C5 [Cleaved into, C5a anaphylatoxin], Fragment

UniProt

P08650

Expression Region

1-77aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF623 AAV Vector (Human) (CMV)
51677101 1 µg

ZNF623 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Syce2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4463908 1.0 µg DNA

Syce2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal SOX17 Antibody (OTI2B6) [Alexa Fluor 488]
NBP2-74299AF488 0.1 mL

Mouse Monoclonal SOX17 Antibody (OTI2B6) [Alexa Fluor 488]

Sign In for Pricing
View Details
LRRC29, NT (LRRC29, FBL9, FBXL9, Leucine-rich repeat-containing protein 29, F-box and leucine-rich repeat protein 9, F-box protein FBL9, F-box/LRR-repeat protein 9) (MaxLight 550) discontinued
037948-ML550 100 µL

LRRC29, NT (LRRC29, FBL9, FBXL9, Leucine-rich repeat-containing protein 29, F-box and leucine-rich repeat protein 9, F-box protein FBL9, F-box/LRR-repeat protein 9) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ETS2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0699406 1.0 µg DNA

ETS2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PA2GC rabbit pAb
E44H16256 100 µL

PA2GC rabbit pAb

Sign In for Pricing
View Details