Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat C5 protein

This Rat C5 protein spans the amino acid sequence from region 1-77aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C5Complement C5 [Cleaved into, C5a anaphylatoxin], Fragment

UniProt

P08650

Expression Region

1-77aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TdT (DNTT) (C-term) Rabbit Polyclonal Antibody
AP54213PU-N 400 µL

TdT (DNTT) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
St13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3183205 3x 1.0 µg

St13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ELISA Kit for Envoplakin (EVPL)
TRV-0045040-01 24 Tests

ELISA Kit for Envoplakin (EVPL)

Sign In for Pricing
View Details
ELISA Kit for Envoplakin (EVPL)
TRV-0045040-02 48 Tests

ELISA Kit for Envoplakin (EVPL)

Sign In for Pricing
View Details
ELISA Kit for Envoplakin (EVPL)
TRV-0045040-03 96 Tests

ELISA Kit for Envoplakin (EVPL)

Sign In for Pricing
View Details
ELISA Kit for Envoplakin (EVPL)
TRV-0045040-04 5x 96 Tests

ELISA Kit for Envoplakin (EVPL)

Sign In for Pricing
View Details