Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat C5 protein

This Rat C5 protein spans the amino acid sequence from region 1-77aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C5Complement C5 [Cleaved into, C5a anaphylatoxin], Fragment

UniProt

P08650

Expression Region

1-77aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBS Buffer with Nacl 150mM; Tris-HCl 10mM; Tween-20 0.05%, pH7.4
TBST-50 1000 PCS/Case

TBS Buffer with Nacl 150mM; Tris-HCl 10mM; Tween-20 0.05%, pH7.4

Sign In for Pricing
View Details
Olr1350 Rat siRNA Oligo Duplex (Locus ID 405022)
SR513109 1 Kit

Olr1350 Rat siRNA Oligo Duplex (Locus ID 405022)

Sign In for Pricing
View Details
Ddx58 siRNA Oligos set (Rat)
17858176 3x 5 nmol

Ddx58 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
TMEM216 ORF Vector (Human) (pORF)
ORF010703 1.0 µg DNA

TMEM216 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
HSDL2 shRNA (h) Lentiviral Particles
sc-92747-V 200 µL

HSDL2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
CXCL5 Polyclonal Antibody, HRP Conjugated
A51690-050 50 µL

CXCL5 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details