Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ubiC protein

This E. coli ubiC protein spans the amino acid sequence from region 2-165aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CL (CPL)

UniProt

P26602

Expression Region

2-165aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SHPALTQLRALRYCKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Cyclin N-terminal domain-containing protein 2 (CNTD2) ELISA Kit
MBS7207923-01 48 Well

Guinea pig Cyclin N-terminal domain-containing protein 2 (CNTD2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cyclin N-terminal domain-containing protein 2 (CNTD2) ELISA Kit
MBS7207923-02 96 Well

Guinea pig Cyclin N-terminal domain-containing protein 2 (CNTD2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cyclin N-terminal domain-containing protein 2 (CNTD2) ELISA Kit
MBS7207923-03 5x 96 Well

Guinea pig Cyclin N-terminal domain-containing protein 2 (CNTD2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cyclin N-terminal domain-containing protein 2 (CNTD2) ELISA Kit
MBS7207923-04 10x 96 Well

Guinea pig Cyclin N-terminal domain-containing protein 2 (CNTD2) ELISA Kit

Sign In for Pricing
View Details
Human GASP-1/WFIKKN2 HEK293 Overexpression Lysate
MBS8114866-01 0.3 mg

Human GASP-1/WFIKKN2 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Human GASP-1/WFIKKN2 HEK293 Overexpression Lysate
MBS8114866-02 5x 0.3 mg

Human GASP-1/WFIKKN2 HEK293 Overexpression Lysate

Sign In for Pricing
View Details