Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Nf2 protein

This Mouse Nf2 protein spans the amino acid sequence from region 1-320aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Moesin-ezrin-radixin-like protein (Neurofibromin-2) (Schwannomin) (Nf-2)

UniProt

P46662

Expression Region

1-320aa

Tag

N-terminal 6xHis-Trx-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zap70 Antibody
MBS9200657-01 0.08 mL

Zap70 Antibody

Sign In for Pricing
View Details
Zap70 Antibody
MBS9200657-02 0.4 mL

Zap70 Antibody

Sign In for Pricing
View Details
Zap70 Antibody
MBS9200657-03 5x 0.4 mL

Zap70 Antibody

Sign In for Pricing
View Details
C12orf29 Polyclonal Antibody
MBS9432783-01 0.05 mL

C12orf29 Polyclonal Antibody

Sign In for Pricing
View Details
C12orf29 Polyclonal Antibody
MBS9432783-02 0.1 mL

C12orf29 Polyclonal Antibody

Sign In for Pricing
View Details
C12orf29 Polyclonal Antibody
MBS9432783-03 5x 0.1 mL

C12orf29 Polyclonal Antibody

Sign In for Pricing
View Details