What is the catalog number for Human PGLYRP1 protein?

The catalog number for Human PGLYRP1 protein is orb604306.

What sizes are available for Human PGLYRP1 protein?

Human PGLYRP1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human PGLYRP1 protein come in?

Human PGLYRP1 protein is available in 3 different pack sizes.

Is Human PGLYRP1 protein in stock?

Human PGLYRP1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human PGLYRP1 protein

This Human PGLYRP1 protein spans the amino acid sequence from region 22-196aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peptidoglycan recognition protein short (PGRP-S) (PGLYRP) (PGRP) (TNFSF3L)

UniProt

O75594

Expression Region

22-196aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP