Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTLA4 protein

This Human CTLA4 protein spans the amino acid sequence from region 37-162aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) (CD_antigen, CD152) (CD152)

UniProt

P16410

Expression Region

37-162aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse EP400 shRNA Plasmid
abx978426-01 150 µg

Mouse EP400 shRNA Plasmid

Sign In for Pricing
View Details
Mouse EP400 shRNA Plasmid
abx978426-02 300 µg

Mouse EP400 shRNA Plasmid

Sign In for Pricing
View Details
Cltb sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7579005 3x 1.0 µg

Cltb sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
C11orf57 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-9939R-BF405 100 µL

C11orf57 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Rabbit anti-MUC13 Antibody
MBS4511676-01 0.05 mL

Rabbit anti-MUC13 Antibody

Sign In for Pricing
View Details
Rabbit anti-MUC13 Antibody
MBS4511676-02 0.1 mL

Rabbit anti-MUC13 Antibody

Sign In for Pricing
View Details