Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Otx2 protein

This Mouse Otx2 protein spans the amino acid sequence from region 1-289aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Orthodenticle homolog 2 (Otx-2)

UniProt

P80206

Expression Region

1-289aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKSSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal EpCAM/TROP1 Antibody (028) [DyLight 594]
NBP2-89605DL594 0.1 mL

Rabbit Monoclonal EpCAM/TROP1 Antibody (028) [DyLight 594]

Sign In for Pricing
View Details
Ear1 Protein Vector (Mouse) (pPB-N-His)
PV174191 500 ng

Ear1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Polyclonal eIF4ENIF1 Antibody
NBP1-89389-25ul 25 µL

Rabbit Polyclonal eIF4ENIF1 Antibody

Sign In for Pricing
View Details
Phospho-FRA1 (Ser265) Polyclonal Antibody, APC Conjugated
bs-3158R-APC-01 20 µL

Phospho-FRA1 (Ser265) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Phospho-FRA1 (Ser265) Polyclonal Antibody, APC Conjugated
bs-3158R-APC-02 100 µL

Phospho-FRA1 (Ser265) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
ZNF670 Rabbit Polyclonal Antibody
orb575798 100 µL

ZNF670 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details