Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus omp25 protein

This Virus omp25 protein spans the amino acid sequence from region 24-213aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Omp25, BruAb1_0720, 25 kDa outer-membrane immunogenic protein

UniProt

Q44664

Expression Region

24-213aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Brucella abortus biovar 1 (strain 9-941)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADAIQEQPPVPAPVEVAPQYSWAGGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4781-3p miRNA Inhibitor
CIH1676-01 10 nmol

Hsa-miR-4781-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-4781-3p miRNA Inhibitor
CIH1676-02 20 nmol

Hsa-miR-4781-3p miRNA Inhibitor

Sign In for Pricing
View Details
Anti-PCBD1 Antibody
MBS8245561-01 0.03 mL

Anti-PCBD1 Antibody

Sign In for Pricing
View Details
Anti-PCBD1 Antibody
MBS8245561-02 0.05 mL

Anti-PCBD1 Antibody

Sign In for Pricing
View Details
Anti-PCBD1 Antibody
MBS8245561-03 0.1 mL

Anti-PCBD1 Antibody

Sign In for Pricing
View Details
Anti-PCBD1 Antibody
MBS8245561-04 0.2 mL

Anti-PCBD1 Antibody

Sign In for Pricing
View Details