Virus omp25 protein
This Virus omp25 protein spans the amino acid sequence from region 24-213aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Omp25, BruAb1_0720, 25 kDa outer-membrane immunogenic protein
UniProt
Q44664
Expression Region
24-213aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Brucella abortus biovar 1 (strain 9-941)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
27.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ADAIQEQPPVPAPVEVAPQYSWAGGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7224293-01 48 Well
Rat Alpha (1, 3) -fucosyltransferase 10 (FUT10) ELISA Kit
Sign In for Pricing
View Details MBS7224293-02 96 Well
Rat Alpha (1, 3) -fucosyltransferase 10 (FUT10) ELISA Kit
Sign In for Pricing
View Details MBS7224293-03 5x 96 Well
Rat Alpha (1, 3) -fucosyltransferase 10 (FUT10) ELISA Kit
Sign In for Pricing
View Details MBS7224293-04 10x 96 Well
Rat Alpha (1, 3) -fucosyltransferase 10 (FUT10) ELISA Kit
Sign In for Pricing
View Details