Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il18 protein

This Mouse Il18 protein spans the amino acid sequence from region 1-192aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon gamma-inducing factor (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma) (IL-18) (Igif)

UniProt

P70380

Expression Region

1-192aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human GPR43 Polyclonal Antibody
PA89246HU-01 50 µg

Rabbit Anti-Human GPR43 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human GPR43 Polyclonal Antibody
PA89246HU-02 100 µg

Rabbit Anti-Human GPR43 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human GPR43 Polyclonal Antibody
PA89246HU-03 500 µg

Rabbit Anti-Human GPR43 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human GPR43 Polyclonal Antibody
PA89246HU-04 1 mg

Rabbit Anti-Human GPR43 Polyclonal Antibody

Sign In for Pricing
View Details
SU 5402
sc-204308 1 mg

SU 5402

Sign In for Pricing
View Details
Isoacyclovir Acetate
TRC-I103200-500MG 500 mg

Isoacyclovir Acetate

Sign In for Pricing
View Details