Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ydhR protein

This E. coli ydhR protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YdhR, b1667, JW1657, Putative monooxygenase YdhR, EC 1.-.-.-

UniProt

P0ACX3

Expression Region

1-101aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATLLQLHFAFNGPFGDAMAEQLKPLAESINQEPGFLWKVWTESEKNHEAGGIYLFTDEKSALAYLEKHTARLKNLGVEEVVAKVFDVNEPLSQINQAKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIST Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-6260R-BF350 100 µL

KIST Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
3- (4-Nitrophenyl) bicyclo[1.1.1]pentane-1-carboxylic acid
OR312478 1 Each

3- (4-Nitrophenyl) bicyclo[1.1.1]pentane-1-carboxylic acid

Sign In for Pricing
View Details
Glycoprotein IIb Fragment (300-312)
MBS8246529-01 1 mg

Glycoprotein IIb Fragment (300-312)

Sign In for Pricing
View Details
Glycoprotein IIb Fragment (300-312)
MBS8246529-02 5 mg

Glycoprotein IIb Fragment (300-312)

Sign In for Pricing
View Details
Glycoprotein IIb Fragment (300-312)
MBS8246529-03 10 mg

Glycoprotein IIb Fragment (300-312)

Sign In for Pricing
View Details
Glycoprotein IIb Fragment (300-312)
MBS8246529-04 5x 10 mg

Glycoprotein IIb Fragment (300-312)

Sign In for Pricing
View Details