Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APOC1 protein

This Human APOC1 protein spans the amino acid sequence from region 27-83aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apolipoprotein C1 (Apo-CI) (ApoC-I)

UniProt

P02654

Expression Region

27-83aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 26C1
522075-01 100 µL

Cytochrome P450 26C1

Sign In for Pricing
View Details
Cytochrome P450 26C1
522075-02 200 µL

Cytochrome P450 26C1

Sign In for Pricing
View Details
Vom1r36 Protein Vector (Rat) (pPM-C-His)
PV315405 500 ng

Vom1r36 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Arse ORF Vector (Rat) (pORF)
ORF063688 1.0 µg DNA

Arse ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Nrtn shRNA (UAS) - Lentiviral mouse Nrtn shRNA (UAS, GFP) plasmid
GTR15280078 1 Vial

Lentiviral mouse Nrtn shRNA (UAS) - Lentiviral mouse Nrtn shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
AMPK1 Protein (N-GST, Human)
P513172 100 µg

AMPK1 Protein (N-GST, Human)

Sign In for Pricing
View Details