Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PDGF B protein

This Human PDGF B protein spans the amino acid sequence from region 82-190aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PDGF-2 (Platelet-derived growth factor B chain) (Platelet-derived growth factor beta polypeptide) (Proto-oncogene c-Sis) (INN, Becaplermin) (PDGF subunit B) (PDGF2) (SIS)

UniProt

P01127

Expression Region

82-190aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD109 (NM_133493) Human Tagged ORF Clone
RG213359 10 µg

CD109 (NM_133493) Human Tagged ORF Clone

Sign In for Pricing
View Details
DUSP9 Protein Vector (Rat) (pPM-C-HA)
18695026 500 ng

DUSP9 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Canine IgA Heavy Chain Secondary Antibody [Biotin]
NB7308B 1 mL

Goat Polyclonal Goat anti-Canine IgA Heavy Chain Secondary Antibody [Biotin]

Sign In for Pricing
View Details
NAB1 Mouse Monoclonal Antibody [Clone:1H3]
E45M15876 100 µg

NAB1 Mouse Monoclonal Antibody [Clone:1H3]

Sign In for Pricing
View Details
Melperone-d4 Hydrochloride
sc-503521 5 mg

Melperone-d4 Hydrochloride

Sign In for Pricing
View Details
JNJ 1661010 50mg
A12420-50 50 mg

JNJ 1661010 50mg

Sign In for Pricing
View Details