Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-G protein

This Human HLA-G protein spans the amino acid sequence from region 25-338aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HLA G antigen (MHC class I antigen G) (HLA-6.0) (HLAG)

UniProt

P17693

Expression Region

25-338aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARIH2OS (NM_001123040) Human Over-expression Lysate
LC426595 20 µg

ARIH2OS (NM_001123040) Human Over-expression Lysate

Sign In for Pricing
View Details
IRF5 Antibody
OC-033-01 50 μL

IRF5 Antibody

Sign In for Pricing
View Details
IRF5 Antibody
OC-033-02 100 µL

IRF5 Antibody

Sign In for Pricing
View Details
IRF5 Antibody
OC-033-03 1 mL

IRF5 Antibody

Sign In for Pricing
View Details
5-Amino-2-mercaptobenzimidazole
TRC-A576965-5G 5 g

5-Amino-2-mercaptobenzimidazole

Sign In for Pricing
View Details
Fibronectin (FN1/2949), 0.2mg/mL
BNUB2949-100 1x 100 µL

Fibronectin (FN1/2949), 0.2mg/mL

Sign In for Pricing
View Details