Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus E7 protein

This Virus E7 protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E7, Protein E7

UniProt

P03129

Expression Region

1-98aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Human papillomavirus type 16

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abcf1 3'UTR Luciferase Stable Cell Line
TU200072 1.0 mL

Abcf1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CD138 (Syndecan-1, SDC1, SDC) (AP) discontinued
030837-AP 200 µL

CD138 (Syndecan-1, SDC1, SDC) (AP) discontinued

Sign In for Pricing
View Details
Oligo, Restriction Site, Cla I (8-mer)
O6015-26 33ug

Oligo, Restriction Site, Cla I (8-mer)

Sign In for Pricing
View Details
Lentiviral human CCDC18 shRNA (UAS) - Lentiviral human CCDC18 shRNA (UAS, RFP) (100)
GTR15316839 1 Vial

Lentiviral human CCDC18 shRNA (UAS) - Lentiviral human CCDC18 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Biotin-Linked Antibody to FK506 Binding Protein 3 (FKBP3)
MBS2005554-01 0.1 mL

Biotin-Linked Antibody to FK506 Binding Protein 3 (FKBP3)

Sign In for Pricing
View Details
Biotin-Linked Antibody to FK506 Binding Protein 3 (FKBP3)
MBS2005554-02 0.2 mL

Biotin-Linked Antibody to FK506 Binding Protein 3 (FKBP3)

Sign In for Pricing
View Details