Virus E7 protein
This Virus E7 protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
E7, Protein E7
UniProt
P03129
Expression Region
1-98aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Human papillomavirus type 16
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
13.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0062563-01 10 µg
Recombinant Deoxyribonuclease I Like Protein 3 (DNASE1L3)
Sign In for Pricing
View Details TRV-0062563-02 50 µg
Recombinant Deoxyribonuclease I Like Protein 3 (DNASE1L3)
Sign In for Pricing
View Details TRV-0062563-03 100 µg
Recombinant Deoxyribonuclease I Like Protein 3 (DNASE1L3)
Sign In for Pricing
View Details TRV-0062563-04 200 µg
Recombinant Deoxyribonuclease I Like Protein 3 (DNASE1L3)
Sign In for Pricing
View Details TRV-0062563-05 500 µg
Recombinant Deoxyribonuclease I Like Protein 3 (DNASE1L3)
Sign In for Pricing
View Details TRV-0062563-06 1 mg
Recombinant Deoxyribonuclease I Like Protein 3 (DNASE1L3)
Sign In for Pricing
View Details