Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF1A protein

This Human TNFRSF1A protein spans the amino acid sequence from region 22-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor 1 (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD_antigen, CD120a) (TNFAR) (TNFR1)

UniProt

P19438

Expression Region

22-211aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VWA3A Protein Vector (Rat) (pPB-C-His)
PV316166 500 ng

VWA3A Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rat Slc12a8 ELISA Kit
ELI-41275r 96 Tests

Rat Slc12a8 ELISA Kit

Sign In for Pricing
View Details
DMEM, High Glucose,  No L-glutamine, No sodium pyruvate
CMP07-001 10x 1 L

DMEM, High Glucose, No L-glutamine, No sodium pyruvate

Sign In for Pricing
View Details
GAMT Knockout 786-O Polyclonal Cells
ARG5295 1 Million

GAMT Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr)
MBS1303137-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr)
MBS1303137-02 0.02 mg (Yeast)

Recombinant Prochlorococcus marinus 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr)

Sign In for Pricing
View Details