Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF1A protein

This Human TNFRSF1A protein spans the amino acid sequence from region 22-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor 1 (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD_antigen, CD120a) (TNFAR) (TNFR1)

UniProt

P19438

Expression Region

22-211aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEC3 antibody
FNab04945 100 µg

MAGEC3 antibody

Sign In for Pricing
View Details
ZNF3 (Zinc Finger Protein 3, Zinc Finger Protein HF.12, Zinc Finger Protein HZF3.1, Zinc Finger Protein KOX25, A8-51, HF.12, KOX25, PP838, Zfp113) (HRP)
MBS6155876-01 0.1 mL

ZNF3 (Zinc Finger Protein 3, Zinc Finger Protein HF.12, Zinc Finger Protein HZF3.1, Zinc Finger Protein KOX25, A8-51, HF.12, KOX25, PP838, Zfp113) (HRP)

Sign In for Pricing
View Details
ZNF3 (Zinc Finger Protein 3, Zinc Finger Protein HF.12, Zinc Finger Protein HZF3.1, Zinc Finger Protein KOX25, A8-51, HF.12, KOX25, PP838, Zfp113) (HRP)
MBS6155876-02 5x 0.1 mL

ZNF3 (Zinc Finger Protein 3, Zinc Finger Protein HF.12, Zinc Finger Protein HZF3.1, Zinc Finger Protein KOX25, A8-51, HF.12, KOX25, PP838, Zfp113) (HRP)

Sign In for Pricing
View Details
USP44 Mouse Monoclonal Antibody [Clone ID: OTI1F9]
TA801918 100 µL

USP44 Mouse Monoclonal Antibody [Clone ID: OTI1F9]

Sign In for Pricing
View Details
PAAVS1-EF1a-COX8-mCherry-Puro Plasmid
PVT82821 2 µg

PAAVS1-EF1a-COX8-mCherry-Puro Plasmid

Sign In for Pricing
View Details
EIF1AY Polyclonal Antibody
MBS9126019-01 0.02 mL

EIF1AY Polyclonal Antibody

Sign In for Pricing
View Details