Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli pal protein

This E. coli pal protein spans the amino acid sequence from region 22-173aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tol-Pal system lipoprotein Pal (excC) (PAL)

UniProt

P0A912

Expression Region

22-173aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM182 siRNA (Human)
orb1853212-01 15 nmol

TMEM182 siRNA (Human)

Sign In for Pricing
View Details
TMEM182 siRNA (Human)
orb1853212-02 30 nmol

TMEM182 siRNA (Human)

Sign In for Pricing
View Details
Permanent Orange (>90%)
TRC-P288563-500MG 500 mg

Permanent Orange (>90%)

Sign In for Pricing
View Details
ZNF25 siRNA (Human)
CRJ6408-01 15 nmol

ZNF25 siRNA (Human)

Sign In for Pricing
View Details
ZNF25 siRNA (Human)
CRJ6408-02 30 nmol

ZNF25 siRNA (Human)

Sign In for Pricing
View Details
CDKN2A ORF Vector (Human) (pORF)
15729011 1.0 µg DNA

CDKN2A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details