What is the catalog number for E. coli pal protein?

The catalog number for E. coli pal protein is orb604795.

What sizes are available for E. coli pal protein?

E. coli pal protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does E. coli pal protein come in?

E. coli pal protein is available in 3 different pack sizes.

Is E. coli pal protein in stock?

E. coli pal protein is currently made to order / not held in immediate stock. Contact us for lead time.

E. coli pal protein

This E. coli pal protein spans the amino acid sequence from region 22-173aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tol-Pal system lipoprotein Pal (excC) (PAL)

UniProt

P0A912

Expression Region

22-173aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY