Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate IL11 protein

This Primate IL11 protein spans the amino acid sequence from region 22-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-11

UniProt

P20808

Expression Region

22-199aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1B10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
11672061 1.0 µg DNA

AKR1B10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PIC 318 RL-TRI 025-B7541 AC Signs
227337 Roll of 250 Pictogram(s)

PIC 318 RL-TRI 025-B7541 AC Signs

Sign In for Pricing
View Details
DAPK1 Monoclonal Antibody
bsm-51758M 100 µL

DAPK1 Monoclonal Antibody

Sign In for Pricing
View Details
C17orf45 sgRNA CRISPR Lentivector (Human) (Target 2)
K0317503 1.0 µg DNA

C17orf45 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
5- (Bromomethyl) -3-ethyl-1,2-oxazole
LBA95862-01 100 mg

5- (Bromomethyl) -3-ethyl-1,2-oxazole

Sign In for Pricing
View Details
5- (Bromomethyl) -3-ethyl-1,2-oxazole
LBA95862-02 1 g

5- (Bromomethyl) -3-ethyl-1,2-oxazole

Sign In for Pricing
View Details