Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate IL11 protein

This Primate IL11 protein spans the amino acid sequence from region 22-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-11

UniProt

P20808

Expression Region

22-199aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TOR1AIP1 shRNA (UAS) - Lentiviral human TOR1AIP1 shRNA (UAS, RFP) plasmid
GTR15333472 1 Vial

Lentiviral human TOR1AIP1 shRNA (UAS) - Lentiviral human TOR1AIP1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
ZNF276 Overexpression Lysate (Native) - (Dry Ice)
NBP2-05409 0.1 mg

ZNF276 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Human CT/Calcitonin ELISA Kit
EK00613E 96 Tests

Human CT/Calcitonin ELISA Kit

Sign In for Pricing
View Details
C22ORF30 (PRR14L) (NM_173566) Human Over-expression Lysate
E45H15235-2 20 µg

C22ORF30 (PRR14L) (NM_173566) Human Over-expression Lysate

Sign In for Pricing
View Details
REEP1 Polyclonal Antibody
MBS9434184-01 0.05 mL

REEP1 Polyclonal Antibody

Sign In for Pricing
View Details
REEP1 Polyclonal Antibody
MBS9434184-02 0.1 mL

REEP1 Polyclonal Antibody

Sign In for Pricing
View Details