Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DNASE1L3 protein

This Human DNASE1L3 protein spans the amino acid sequence from region 21-305aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNase I homolog protein DHP2 (Deoxyribonuclease I-like 3) (DNase I-like 3) (Liver and spleen DNase) (LS-DNase) (LSD) (DNase gamma) (DHP2) (DNAS1L3)

UniProt

Q13609

Expression Region

21-305aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-SLC24A3-shRNA1-CopGFP-Puro Plasmid
PVT83559 2 µg

PLV3-U6-SLC24A3-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
ADAP2 Peptide - middle region
MBS3247528-01 0.1 mg

ADAP2 Peptide - middle region

Sign In for Pricing
View Details
ADAP2 Peptide - middle region
MBS3247528-02 5x 0.1 mg

ADAP2 Peptide - middle region

Sign In for Pricing
View Details
Anti-Caspase 9 antibody
STJ96979 200 µl

Anti-Caspase 9 antibody

Sign In for Pricing
View Details
Recombinant Human KITLG/SCF Protein, N-His
AP91195 50 µg

Recombinant Human KITLG/SCF Protein, N-His

Sign In for Pricing
View Details
TGFβ RIII (A-4) Alexa Fluor® 680
sc-74511 AF680 200 µg/mL

TGFβ RIII (A-4) Alexa Fluor® 680

Sign In for Pricing
View Details