Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DNASE1L3 protein

This Human DNASE1L3 protein spans the amino acid sequence from region 21-305aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNase I homolog protein DHP2 (Deoxyribonuclease I-like 3) (DNase I-like 3) (Liver and spleen DNase) (LS-DNase) (LSD) (DNase gamma) (DHP2) (DNAS1L3)

UniProt

Q13609

Expression Region

21-305aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Component of Oligomeric Golgi Complex 3 (COG3) Antibody
abx231829 100 µg

Component of Oligomeric Golgi Complex 3 (COG3) Antibody

Sign In for Pricing
View Details
Phospho-IP3 Receptor (Ser1598) Antibody
AF3591-01 100 µL

Phospho-IP3 Receptor (Ser1598) Antibody

Sign In for Pricing
View Details
Phospho-IP3 Receptor (Ser1598) Antibody
AF3591-02 200 µL

Phospho-IP3 Receptor (Ser1598) Antibody

Sign In for Pricing
View Details
Rat Transforming Growth Factor Alpha ELISA Kit
MBS765046-01 48 Well

Rat Transforming Growth Factor Alpha ELISA Kit

Sign In for Pricing
View Details
Rat Transforming Growth Factor Alpha ELISA Kit
MBS765046-02 96 Well

Rat Transforming Growth Factor Alpha ELISA Kit

Sign In for Pricing
View Details
Rat Transforming Growth Factor Alpha ELISA Kit
MBS765046-03 5x 96 Well

Rat Transforming Growth Factor Alpha ELISA Kit

Sign In for Pricing
View Details