Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi HWP1 protein

This Fungi HWP1 protein spans the amino acid sequence from region 27-203aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell elongation protein 2 (ECE2)

UniProt

P46593

Expression Region

27-203aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQGETEEALIQKRSYDYYQEPCDDYPQQQQQQEPCDYPQQQQQEEPCDYPQQQPQEPCDYPQQPQEPCDYPQQPQEPCDYPQQPQEPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDQPDDNPPIPNIPTDWIPNIPTDWIPDIPEKPTTPATTPNIPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat EGF Protein (Gst Tag)
PDER100116-01 20 µg

Recombinant Rat EGF Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Rat EGF Protein (Gst Tag)
PDER100116-02 100 µg

Recombinant Rat EGF Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Rat EGF Protein (Gst Tag)
PDER100116-03 500 µg

Recombinant Rat EGF Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Rat EGF Protein (Gst Tag)
PDER100116-04 1 mg

Recombinant Rat EGF Protein (Gst Tag)

Sign In for Pricing
View Details
IDH3G Polyclonal Antibody
E-AB-14638-01 20 µL

IDH3G Polyclonal Antibody

Sign In for Pricing
View Details
IDH3G Polyclonal Antibody
E-AB-14638-02 60 µL

IDH3G Polyclonal Antibody

Sign In for Pricing
View Details