Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi HWP1 protein

This Fungi HWP1 protein spans the amino acid sequence from region 27-203aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell elongation protein 2 (ECE2)

UniProt

P46593

Expression Region

27-203aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQGETEEALIQKRSYDYYQEPCDDYPQQQQQQEPCDYPQQQQQEEPCDYPQQQPQEPCDYPQQPQEPCDYPQQPQEPCDYPQQPQEPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDQPDDNPPIPNIPTDWIPNIPTDWIPDIPEKPTTPATTPNIPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), CF488A conjugate, 0.1mg/mL
BNC883732-100 1x 100 µL

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C19orf12 Human Gene Knockout Kit (CRISPR)
KN416851 1 Kit

C19orf12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PKC theta (PRKCQ) Rabbit Polyclonal Antibody
TA380369 100 µL

PKC theta (PRKCQ) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WASP (WAS) (Center) Rabbit Polyclonal Antibody
AP54531PU-N 400 µL

WASP (WAS) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TEDC1 (NM_001198983) Human Over-expression Lysate
LY434179 100 µg

TEDC1 (NM_001198983) Human Over-expression Lysate

Sign In for Pricing
View Details
Human M-CSF/CSF1 (33-190), Tag Free
HA210919-01 20 µg

Human M-CSF/CSF1 (33-190), Tag Free

Sign In for Pricing
View Details