Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria bla protein

This Bacteria bla protein spans the amino acid sequence from region 22-286aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Shv5

UniProt

P0A3M1

Expression Region

22-286aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Klebsiella pneumoniae

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human Stat4 Polyclonal Antibody
PA84921HU-01 50 µg

Rabbit Anti-Human Stat4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Stat4 Polyclonal Antibody
PA84921HU-02 100 µg

Rabbit Anti-Human Stat4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Stat4 Polyclonal Antibody
PA84921HU-03 500 µg

Rabbit Anti-Human Stat4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Stat4 Polyclonal Antibody
PA84921HU-04 1 mg

Rabbit Anti-Human Stat4 Polyclonal Antibody

Sign In for Pricing
View Details
Upf2 ORF Vector (Mouse) (pORF)
ORF061065 1.0 µg DNA

Upf2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
FOXO3 (pS253) Antibody
MBS8582774-01 0.1 mL

FOXO3 (pS253) Antibody

Sign In for Pricing
View Details