Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli bamA protein

This E. coli bamA protein spans the amino acid sequence from region 175-424aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Omp85 (yaeT) (yzzN) (yzzY)

UniProt

P0A940

Expression Region

175-424aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serum Amyloid A (SAA1) Mouse Monoclonal Antibody [Clone ID: OTI4B3]
TA814010S 30 µL

Serum Amyloid A (SAA1) Mouse Monoclonal Antibody [Clone ID: OTI4B3]

Sign In for Pricing
View Details
FRA7B Protein Lysate (Human) with C-Ha Tag
20907031 100 µg

FRA7B Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Thymol Violet pH Indicator
323185-01 5 g

Thymol Violet pH Indicator

Sign In for Pricing
View Details
Thymol Violet pH Indicator
323185-02 25 g

Thymol Violet pH Indicator

Sign In for Pricing
View Details
Lentiviral human STAT5B shRNA (UAS) - Lentiviral human STAT5B shRNA (UAS, GFP) (25)
GTR15333515 1 Vial

Lentiviral human STAT5B shRNA (UAS) - Lentiviral human STAT5B shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal POLR2D Antibody
NBP2-93656-0.02mL 0.02 mL

Rabbit Polyclonal POLR2D Antibody

Sign In for Pricing
View Details