Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Eisenia foetida Lysenin-related protein 2 protein

This Plant Eisenia foetida Lysenin-related protein 2 protein spans the amino acid sequence from region 24-270aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RRNA N-glycosidase (Alpha-TCS)

UniProt

P09989

Expression Region

24-270aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AR Polyclonal Antibody
PHC80301 100 μg

Anti-AR Polyclonal Antibody

Sign In for Pricing
View Details
LRRC8C Lentiviral Activation Particles (h)
sc-413584-LAC 200 µL

LRRC8C Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Octadecanoic-18,18,18-d3 Acid
TRC-S686499-5MG 5 mg

Octadecanoic-18,18,18-d3 Acid

Sign In for Pricing
View Details
2- (3- (Dibenzo[b, d]furan-2-yl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
OR1052571-01 250 mg

2- (3- (Dibenzo[b, d]furan-2-yl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing
View Details
2- (3- (Dibenzo[b, d]furan-2-yl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
OR1052571-02 1 g

2- (3- (Dibenzo[b, d]furan-2-yl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing
View Details
2- (3- (Dibenzo[b, d]furan-2-yl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
OR1052571-03 5 g

2- (3- (Dibenzo[b, d]furan-2-yl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing
View Details