Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MUC2 protein

This Human MUC2 protein spans the amino acid sequence from region 36-240aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Intestinal mucin-2 (MUC-2) (SMUC)

UniProt

Q02817

Expression Region

36-240aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRARP Polyclonal Conjugated Antibody
C27828 100 µL

NRARP Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
CD4 (AP) discontinued
227417-AP 100 µL

CD4 (AP) discontinued

Sign In for Pricing
View Details
TMCO2 Protein Vector (Mouse) (pPM-C-His)
PV238833 500 ng

TMCO2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
OR13C5 antibody - N-terminal region (ARP32862_P050)
ARP32862_P050 100 µL

OR13C5 antibody - N-terminal region (ARP32862_P050)

Sign In for Pricing
View Details
Human Lymphotoxin beta/TNFSF3 (NP_002332.1) VersaClone cDNA
RDC3228 10 µg

Human Lymphotoxin beta/TNFSF3 (NP_002332.1) VersaClone cDNA

Sign In for Pricing
View Details
EIF4A2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV709697 1.0 µg DNA

EIF4A2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details