Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Prss1 protein

This Rat Prss1 protein spans the amino acid sequence from region 24-246aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anionic trypsin I (Pretrypsinogen I) (Serine protease 1) (Try1)

UniProt

P00762

Expression Region

24-246aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastric Juice Peptide Fragment
H-2074.0500 0.5mg

Gastric Juice Peptide Fragment

Sign In for Pricing
View Details
FOS Rabbit Polyclonal Antibody
orb592712 100 µL

FOS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Tissue Polypeptide Antigen (TPA) ELISA Kit
orb1657434-01 48 Tests

Human Tissue Polypeptide Antigen (TPA) ELISA Kit

Sign In for Pricing
View Details
Human Tissue Polypeptide Antigen (TPA) ELISA Kit
orb1657434-02 96 Tests

Human Tissue Polypeptide Antigen (TPA) ELISA Kit

Sign In for Pricing
View Details
Human Golgi Membrane Protein 1 Recombinant Protein C-6 His Tag Lyophilized 50UG
IHUGMP1RC6HISLY50UG 50 µg

Human Golgi Membrane Protein 1 Recombinant Protein C-6 His Tag Lyophilized 50UG

Sign In for Pricing
View Details
Histone H2AZ Antibody
AF4666-01 50 µL

Histone H2AZ Antibody

Sign In for Pricing
View Details