Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish CHRNA1 protein

This Fish CHRNA1 protein spans the amino acid sequence from region 25-234aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHRNA1Acetylcholine receptor subunit alpha

UniProt

P02710

Expression Region

25-234aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Tetronarce californica (Pacific electric ray) (Torpedo californica)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp40 (DNAJB1) Mouse Monoclonal Antibody [Clone ID: OTI1B12]
TA502245 100 µL

Hsp40 (DNAJB1) Mouse Monoclonal Antibody [Clone ID: OTI1B12]

Sign In for Pricing
View Details
NANOGNBP3 Recombinant Protein (Human)
RP077658 100 µg

NANOGNBP3 Recombinant Protein (Human)

Sign In for Pricing
View Details
Lentiviral human SYT9 sgRNA gene knockout kit - Lentiviral human SYT9 sgRNA gene knockout kit (plasmid)
GTR15354985 1 Vial

Lentiviral human SYT9 sgRNA gene knockout kit - Lentiviral human SYT9 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
IL-2 Protein (N-GST, Rat)
P516129 100 µg

IL-2 Protein (N-GST, Rat)

Sign In for Pricing
View Details
Recombinant Human Proteasome subunit beta type-7 (PSMB7), partial
orb1651897-01 20 µg

Recombinant Human Proteasome subunit beta type-7 (PSMB7), partial

Sign In for Pricing
View Details
Recombinant Human Proteasome subunit beta type-7 (PSMB7), partial
orb1651897-02 100 µg

Recombinant Human Proteasome subunit beta type-7 (PSMB7), partial

Sign In for Pricing
View Details