Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish CHRNA1 protein

This Fish CHRNA1 protein spans the amino acid sequence from region 25-234aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHRNA1Acetylcholine receptor subunit alpha

UniProt

P02710

Expression Region

25-234aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Tetronarce californica (Pacific electric ray) (Torpedo californica)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Peroxiredoxin 1  (4B11-D10)
YF-MA14585 100 ug

Anti-Peroxiredoxin 1 (4B11-D10)

Sign In for Pricing
View Details
RILPL2 CRISPR Activation Plasmid (h2)
sc-414956-ACT-2 20 µg

RILPL2 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
LINS1 Antibody Middle region
ARP96846_P050 100 µL

LINS1 Antibody Middle region

Sign In for Pricing
View Details
Human Contactin-4 ELISA Kit PicoKine®
EK1780 96 Well With Removable Strips

Human Contactin-4 ELISA Kit PicoKine®

Sign In for Pricing
View Details
Human Normal Peripheral Blood Mononuclear Cells (PBMC)
PBMC-C10M 10 million

Human Normal Peripheral Blood Mononuclear Cells (PBMC)

Sign In for Pricing
View Details
NMRAL1 Polyclonal Antibody, FITC Conjugated
A60048-100 100 µL

NMRAL1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details