Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish CHRNA1 protein

This Fish CHRNA1 protein spans the amino acid sequence from region 25-234aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHRNA1Acetylcholine receptor subunit alpha

UniProt

P02710

Expression Region

25-234aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Tetronarce californica (Pacific electric ray) (Torpedo californica)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IL-23 Antibody (207) [Janelia Fluor 646]
NBP3-26067JF646 0.1 mL

Rabbit Monoclonal IL-23 Antibody (207) [Janelia Fluor 646]

Sign In for Pricing
View Details
ECEL1 Protein Vector (Mouse) (pPB-C-His)
PV174310 500 ng

ECEL1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
BMF Mouse Monoclonal Antibody [Clone ID: OTI5H2]
TA807512S 30 µL

BMF Mouse Monoclonal Antibody [Clone ID: OTI5H2]

Sign In for Pricing
View Details
IkB-a discontinued
347675-01 100 µL

IkB-a discontinued

Sign In for Pricing
View Details
IkB-a discontinued
347675-02 200 µL

IkB-a discontinued

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis Pyridoxine 5'-phosphate synthase (pdxJ)
MBS1352897-01 0.02 mg (E-Coli)

Recombinant Idiomarina loihiensis Pyridoxine 5'-phosphate synthase (pdxJ)

Sign In for Pricing
View Details