Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Plaa protein

This Mouse Plaa protein spans the amino acid sequence from region 495-584aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLA2P (PLAP) (Plap)

UniProt

P27612

Expression Region

495-584aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AK1 Antibody
OACA08583-100UL 100 µL

AK1 Antibody

Sign In for Pricing
View Details
C8A Rabbit Polyclonal Antibody
orb2951206-01 50 µg

C8A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C8A Rabbit Polyclonal Antibody
orb2951206-02 100 µg

C8A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DLEC1 Double Nickase Plasmid (m2)
sc-435740-NIC-2 20 µg

DLEC1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
BTZ043 Racemate
C16107-01 5 mg

BTZ043 Racemate

Sign In for Pricing
View Details
BTZ043 Racemate
C16107-02 10 mM / 1 mL

BTZ043 Racemate

Sign In for Pricing
View Details