Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat TGF beta Receptor 2 protein

This Rat TGF beta Receptor 2 protein spans the amino acid sequence from region 24-166aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TGF-beta type II receptor (Transforming growth factor-beta receptor type II) (TGF-beta receptor type II) (TbetaR-II) (TGFR-2)

UniProt

P38438

Expression Region

24-166aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Pancreas
CS623583 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
EDG1 (S1PR1) Rabbit Polyclonal Antibody
AP01462PU-N 100 µg

EDG1 (S1PR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TGFalpha (P/T1), CF568 conjugate, 0.1mg/mL
BNC680787-100 1x 100 µL

TGFalpha (P/T1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti Human CEACAM5 Polyclonal
Y054537 100 µL

Anti Human CEACAM5 Polyclonal

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF405S conjugate, 0.1mg/mL
BNC042095-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 Recombinant Rabbit monoclonal Antibody [SA35-08]
ET1601-9-50UL 50 µL

CD9 Recombinant Rabbit monoclonal Antibody [SA35-08]

Sign In for Pricing
View Details