Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat TGF beta Receptor 2 protein

This Rat TGF beta Receptor 2 protein spans the amino acid sequence from region 24-166aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TGF-beta type II receptor (Transforming growth factor-beta receptor type II) (TGF-beta receptor type II) (TbetaR-II) (TGFR-2)

UniProt

P38438

Expression Region

24-166aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (N/A), 0.2mg/mL
BNUB1851-100 1x 100 µL

P53 Tumor Suppressor Protein (N/A), 0.2mg/mL

Sign In for Pricing
View Details
Adamantane
TRC-A207800-25G 25 g

Adamantane

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS808938 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
ANKRD13A Polyclonal Antibody
E-AB-90158-01 60 µL

ANKRD13A Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD13A Polyclonal Antibody
E-AB-90158-02 120 µL

ANKRD13A Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD13A Polyclonal Antibody
E-AB-90158-03 200 µL

ANKRD13A Polyclonal Antibody

Sign In for Pricing
View Details