Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus DBP protein

This Virus DBP protein spans the amino acid sequence from region 174-529aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Early 2A protein (Early E2A DNA-binding protein) (DBP)

UniProt

P03265

Expression Region

174-529aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSKKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYRNSRAQGGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTAN1, CT (NTAN1, Protein N-terminal asparagine amidohydrolase, Protein NH2-terminal asparagine amidohydrolase, Protein NH2-terminal asparagine deamidase) (PE) discontinued
039179-PE 200 µL

NTAN1, CT (NTAN1, Protein N-terminal asparagine amidohydrolase, Protein NH2-terminal asparagine amidohydrolase, Protein NH2-terminal asparagine deamidase) (PE) discontinued

Sign In for Pricing
View Details
Human VWA1 Recombinant Protein (N-His)
HV812022-01 50 µg

Human VWA1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human VWA1 Recombinant Protein (N-His)
HV812022-02 100 µg

Human VWA1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human VWA1 Recombinant Protein (N-His)
HV812022-03 1 mg

Human VWA1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Tie2 HEK-293 Cell Line
ABC-X0287F 1 Vial

Tie2 HEK-293 Cell Line

Sign In for Pricing
View Details
CORM-401
C03733-5mg 5 mg

CORM-401

Sign In for Pricing
View Details